PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 437aa    MW: 49546.4 Da    PI: 4.9524
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS314.91.7e-96644363374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL+ecA+a+s++d +++++lL+ l+elasp+gd  q++a+yf++AL  + ++s+ ++yk+l++ ++++++ +++ +    f+e+sP+ +f+h++
  XP_015886865.1  64 RLLMECARAISEKDSSKIHHLLWMLNELASPYGDCDQKIAFYFLQALFCKATDSGLRCYKTLTSVAEKSHSFDSARKLILKFQELSPWTTFGHVA 158
                     79************************************************************9999985554444444445************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.vakrledlel 191
                      N aIlea+ege+++HiiD + + ++QWp+Ll+aLa+R++++p+l++T+v+  +s  +  ++e+ +r++kfA+ +gvpfefnv+   ++l +l+ 
  XP_015886865.1 159 SNGAILEALEGETKLHIIDVSNTLCTQWPTLLEALATRNDETPRLKLTVVVT-ASIVNLVMKEISQRMEKFARLMGVPFEFNVIsGLNHLGELTK 252
                     ****************************************************.56799*************************955679****** PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealeyysalfdsleaklpreseerik 284
                     e L v+++Ea+aVn++ +l r+      +e+ r++v+++++sl+Pkvv+vve+ead   ++++F++ f e+l++y+  fd+le+++ ++s+e+ +
  XP_015886865.1 253 EGLGVQEDEAIAVNCIGSLRRVE-----VEE-REAVIRMFQSLRPKVVTVVEEEADFstSRNDFVKCFEECLRFYTLYFDMLEESFVPTSNEKLM 341
                     *********************97.....444.889*******************998546679******************************** PP

            GRAS 285 vErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve......eesgslvlgWkdrpLvsvS 371
                     +Ere+l r+iv v++c +++    er+e+ ++W+erl+ea F pv +s+++++++k+ll+++   g+++        ++  ++l+Wk++p v++S
  XP_015886865.1 342 LERECL-RSIVRVLSCDEENdrECERREKGSQWSERLKEA-FLPVGFSDDVVDDVKALLKRYR-TGWSLAlpqgevAHDSGIYLTWKEEPAVWAS 433
                     ****76.789999999776642469*************98.**********************.7778776666655688889************ PP

            GRAS 372 aWr 374
                     aW+
  XP_015886865.1 434 AWK 436
                     **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.48236411IPR005202Transcription factor GRAS
PfamPF035146.0E-9464436IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MDITLFTPKE AHFLNSSKQI INGLAEAAID MQSSNQQQPQ NSHTSTSRSS DSGEPCPSDK  60
WASRLLMECA RAISEKDSSK IHHLLWMLNE LASPYGDCDQ KIAFYFLQAL FCKATDSGLR  120
CYKTLTSVAE KSHSFDSARK LILKFQELSP WTTFGHVASN GAILEALEGE TKLHIIDVSN  180
TLCTQWPTLL EALATRNDET PRLKLTVVVT ASIVNLVMKE ISQRMEKFAR LMGVPFEFNV  240
ISGLNHLGEL TKEGLGVQED EAIAVNCIGS LRRVEVEERE AVIRMFQSLR PKVVTVVEEE  300
ADFSTSRNDF VKCFEECLRF YTLYFDMLEE SFVPTSNEKL MLERECLRSI VRVLSCDEEN  360
DRECERREKG SQWSERLKEA FLPVGFSDDV VDDVKALLKR YRTGWSLALP QGEVAHDSGI  420
YLTWKEEPAV WASAWKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-36664368375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886865.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-141SHR_ARATH; Protein SHORT-ROOT
TrEMBLM5XBH60.0M5XBH6_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s05450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-128GRAS family protein